Tag: Modulator

For research use only. We do not sell to patients. CB1R Allosteric modulator 1 CAS No. : 2513102-41-3 Biological Activity：CB1R Allosteric modulator 1 (compound 11) is a potent CB1R allosteric modulator. CB1R Allosteric modulator 1 shows negatively affects the functional activity of orthosteric ligands (NAM) at CB1Rs. Research Area：Others Targets：Cannabinoid Receptor Related Small Molecules:Pregnenolone monosulfate […]

For research use only. We do not sell to patients. Etiocholanolone-d2 CAS No. : 2687960-82-1 Biological Activity：Etiocholanolone-d2 is the deuterium labeled Etiocholanolone. Etiocholanolone (5β-Androsterone) is the excreted metabolite of testosterone and has anticonvulsant activity. Etiocholanolone is a less potent neurosteroid positive allosteric modulator (PAM) of the GABAA receptor than its enantiomer form[2][3]. Targets：GABA Receptor|Endogenous Metabolite Related Small Molecules:D-α-Hydroxyglutaric acid […]

For research use only. We do not sell to patients. Nardoguaianone J CAS No. : 443128-64-1 Biological Activity：Nardoguaianone J, a guaiane-type compound, can be isolated from Nardostachys chinensis roots. Nardoguaianone J can enhance SERT activity[2]. Research Area：Neurological Disease Targets：Serotonin Transporter Related Small Molecules:Ansofaxine;Edivoxetine hydrochloride;DSP-1053;Azaphen dihydrochloride monohydrate;Wf-516;Nitroxazepine;SPD-473 citrate;Indalpine;Pseudoisocyanine iodide;Roxindole;Cinchonidine;Eplivanserin (mixture);AChE-IN-5;Tesofensine Trending products：Recombinant Proteins  |  Bioactive Screening […]

For research use only. We do not sell to patients. Raloxifene 4′-glucuronide-d4 lithium Biological Activity：Raloxifene 4′-glucuronide-d4 (lithium) is deuterium labeled Raloxifene 4′-glucuronide. Raloxifene 4′-glucuronide is a primary metabolite of Raloxifene. Raloxifene 4′-glucuronide formation is mediated mostly by UGT1A10 and UGT1A8. Raloxifene 4′-glucuronide binds to estrogen receptor with an IC50 of 370 μM. [2]. Raloxifene is […]

For research use only. We do not sell to patients. GLP-1R modulator C16 CAS No. : 875005-43-9 Biological Activity：GLP-1R modulator C16 is an allosteric modulator enhancing GLP-1 binding to GLP-1R via a transmembrane site (EC50 8.43 ± 3.82 μM). Research Area：Metabolic Disease Targets：GCGR Related Small Molecules:BETP;GLP-1R agonist 4;VU0453379;PF-06291874;Utreglutide;TT-OAD2;Efocipegtrutide;GLP-1 receptor agonist 2;NNC-0640;Cochinchinenin C;{Val1}-Exendin-3/4;GLP-1(28-36)amide TFA;Exendin-4 acetate;Glepaglutide;GLP-1(7-37);GLP-1 receptor […]

For research use only. We do not sell to patients. m7GpppAmpG ammonium Biological Activity：m7GpppAmpG ammonium is a trinucleotide 5′ cap analog with the capping efficiencies for the obtained RNAs of 90%. Research Area：Others Targets：DNA/RNA Synthesis Related Small Molecules:Ametantrone;ddCTP trisodium;7-TFA-ap-7-Deaza-dA;P1788;Thymidine-13C5,15N;NSC 617145;116-9e;DNA Gyrase-IN-5;DMT-2′-F-Bz-dA;6-Thio-2′-Deoxyguanosine;Antitumor agent-74;Risdiplam;TH287 hydrochloride;Direct Black 38;7-TFA-ap-7-Deaza-ddA;BCH001;NKP-1339;Fialuridine;2′-O-MOE-5-Me-rC;PTC299;2′-F-Bz-dC Phosphoramidite Trending products：Recombinant Proteins  |  Bioactive Screening Libraries  |  Natural […]

For research use only. We do not sell to patients. Biotin-Substance P CAS No. : 87468-58-4 Biological Activity：Biotin-Substance P is the biotin tagged Substance P. Substance P (Neurokinin P) is a neuropeptide, acting as a neurotransmitter and as a neuromodulator in the CNS. The endogenous receptor for substance P is neurokinin 1 receptor (NK1-receptor, NK1R). […]

For research use only. We do not sell to patients. BI-1408 CAS No. : 2231075-94-6 Biological Activity：BI-1408 is a potent γ secretase modulator with an IC50 of 0.04 μM for Aβ42. Research Area：Neurological Disease Targets：γ-secretase Related Small Molecules:γ-Secretase modulator 4;ELN318463;Crenigacestat;Aβ42-IN-1 free base;Fosciclopirox;JNJ-40418677;gamma-secretase modulator 3;γ-Secretase modulator 11 hydrochloride;γ-Secretase modulator 12;Aβ42-IN-2;DAPT (GMP);BPN-15606;LY-411575 (isomer 3);BMS 433796;YO-01027 (GMP);Nirogacestat dihydrobromide;gamma-secretase […]

For research use only. We do not sell to patients. LSN3318839 Biological Activity：LSN3318839 is an orally efficacious positive allosteric modulator of the glucagon-like peptide-1 receptor (GLP-1R). Research Area：Metabolic Disease Targets：GCGR Related Small Molecules:BETP;GLP-1R agonist 4;VU0453379;PF-06291874;Utreglutide;TT-OAD2;Efocipegtrutide;GLP-1 receptor agonist 2;NNC-0640;Cochinchinenin C;{Val1}-Exendin-3/4;GLP-1(28-36)amide TFA;Exendin-4 acetate;Glepaglutide;GLP-1(7-37);GLP-1 receptor agonist 4;Avexitide;Exendin-3/4 (59-86);FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS;GLP-1R modulator C16;GLP-1(9-36)amide;GLP-1R agonist 5 Trending products：Recombinant Proteins  |  Bioactive Screening […]

For research use only. We do not sell to patients. BMS-986188 CAS No. : 1776115-10-6 Biological Activity：BMS-986188 is a selective positive allosteric modulator of δ-opioid receptor with an EC50 of 0.05 μM. Research Area：Neurological Disease Targets：Opioid Receptor Related Small Molecules:ORL1 antagonist 1;Loperamide-d6 N-Oxide;Deltorphin 2 TFA;Nalfurafine;β-Lipotropin (60-65);GSK1521498 free base;Trimebutine-d5 fumarate;Dynorphin B (1-13) (TFA);Dermorphin Analog;β-Endorphin (6-31), human;JTC-801;Valorphin;Corydaline;TAN-452;Matrine;Naloxonazine […]