Tag: Modulator

For research use only. We do not sell to patients. AM-1488 CAS No. : 2079895-60-4 Biological Activity：AM-1488 is a potent, orally active glycine receptor (GlyR) potentiator (hGlyRα3 EC50=0.45 μM)[2]. Research Area：Neurological Disease Targets：Others Related Small Molecules:Immune initiator-1;Obiltoxaximab;DIBAC-GGFG-NH2CH2-Dxd;Cyanine5.5 maleimide chloride;Cymarin;Z-Glycine;2-Deoxy-2-fluoro-D-glucose-13C,d7;Water-18O;Fmoc-N-Me-D-Ala-OH;3,5-Diiodo-L-tyrosine;N3-Pen-Dde;Zimeldine-d6;Ornidazole diol;Nylidrin hydrochloride;PFI-653;N-Arachidonoyl Taurine-d4;OVA Peptide (323-339);((3-Fluorophenyl)sulfonyl)glycine;7ß-Hydroxycholesterol-d7;MALAT1-IN-1;Sibiricose A1;Mefruside-d3;Ethacrynic acid mercapturate-d3;FLAG peptide;Neocurdione Trending products：Recombinant Proteins  |  Bioactive Screening Libraries  […]

For research use only. We do not sell to patients. TCH-165 CAS No. : 1446350-60-2 Biological Activity：TCH-165 is a small molecule modulator of proteasome assembly, which increases 20S levels and facilitates 20S-mediated protein degradation. Research Area：Cancer Targets：Proteasome Related Screening Libraries:Bioactive Compound Library Plus;Metabolism/Protease Compound Library;Anti-Cancer Compound Library;Ubiquitination Compound Library;Targeted Diversity Library; Related Small Molecules:Calpeptin;Calpain Inhibitor […]

For research use only. We do not sell to patients. Arundic Acid-d3 CAS No. : 1246816-50-1 Biological Activity：Arundic Acid-d3 (ONO-2506-d3) is the deuterium labeled Arundic Acid. Arundic acid (ONO-2506) is an astrocyte-modulating agent, which delays the expansion of cerebral infarcts by modulating the activation of astrocytes through inhibition of S-100β synthesis. Arundic acid has the […]

For research use only. We do not sell to patients. Raloxifene 4-Monomethyl Ether CAS No. : 185415-07-0 Biological Activity：Raloxifene 4-Monomethyl Ether (Compound 37) is a Raloxifene derivative that inhibits estrogen receptor α. Raloxifene 4-Monomethyl Ether inhibits MCF-7 cells with an IC50 of 1 μM and a pIC50 of 6. Targets：Estrogen Receptor/ERR Related Small Molecules:DS20362725;LSD1/ER-IN-1;Giredestrant;Avobenzone;Estriol-d3;Chrysin;ERRγ Inverse […]

For research use only. We do not sell to patients. MSDC 0160 CAS No. : 146062-49-9 Biological Activity：MSDC 0160 (Mitoglitazone) is a mitochondrial target of thiazolidinediones (mTOT)-modulating insulin sensitizer and a modulator of mitochondrial pyruvate carrier (MPC). MSDC 0160 is a thiazolidinedione (TZD) with antidiabetic and neuroprotective activities. MSDC 0160 has the potential for Alzheimer′s […]

For research use only. We do not sell to patients. Kv3 modulator 3 CAS No. : 1498186-01-8 Biological Activity：Kv3 modulator 3 (Compound 4) is a selective modulator of Kv3.1 and/or Kv3.2 and/or Kv3.3 channels extracted from patent WO2017098254A1, compound 4, has analgesic activity for use in the prophylaxis o or treatment of pain. Research Area：Inflammation/Immunology […]

For research use only. We do not sell to patients. 10(S),17(S)-DiHDHA CAS No. : 871826-47-0 Biological Activity：10(S),17(S)-DiHDHA (also known as neuroprotectin D1 when produced in neuronal tissues) is a DHA-derived dihydroxy fatty acid that exhibits potent protective and anti-inflammatory activities[2]. Research Area：Inflammation/Immunology Targets：Endogenous Metabolite Related Small Molecules:D-α-Hydroxyglutaric acid disodium;Nicotinamide N-oxide;3-Hydroxyglutaric acid-d5;DPPC-d62;SDMA-d6;2-Mercaptobenzothiazole;N-Acetyl-L-glutamic acid-d5;(3R,5S)-3-Hydroxy Cotinine-d3;Biliverdin hydrochloride;D-Glucose-13C,d1-3;2,3-Diaminopropionic acid […]

For research use only. We do not sell to patients. Linsidomine hydrochloride CAS No. : 16142-27-1 Biological Activity：SIN-1 (chloride) is the active metabolite of molsidomine. SIN-1 (chloride) exhibits potent vasorelaxant effect and inhibition of platelet aggregation. SIN-1 (chloride) decreases myocardial necrosis and reperfusion-induced endothelial dysfunction in models of myocardial ischemia-reperfusion[2]. Research Area：Cardiovascular Disease Targets：Drug Metabolite […]

For research use only. We do not sell to patients. Dalzanemdor CAS No. : 1629853-48-0 Biological Activity：Dalzanemdor (SAGE-718) is a N-methyl-D-aspartate (NMDA) receptor positive allosteric modulator. Research Area：Others Targets：iGluR Related Small Molecules:CIQ;Quinolinic acid-d3;1-Aminocyclobutanecarboxylic acid;Glycine-1-13C,15N;ZL006;PYD-106;NMDA-IN-2;JAMI1001A;(S)-Willardiine;Fanapanel;(S)-AMPA;L-Glutamic acid-15N,d5;PDZ1 Domain inhibitor peptide TFA;Ifenprodil tartrate;Rislenemdaz;Coluracetam;Flupirtine-d4 hydrochloride;DL-Phenylalanine-d5 hydrochloride;NMDA;CFM-2;Lanicemine dihydrochloride;L-Phenylalanine-13C9;VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA;L-Glutamic acid monosodium salt;Glycine-15N;Ibotenic acid;GYKI-47261 dihydrochloride;Sunifiram Trending products：Recombinant Proteins  |  Bioactive Screening […]

For research use only. We do not sell to patients. Didesmethyl cariprazine CAS No. : 839712-25-3 Biological Activity：Didesmethyl cariprazine is a metabolite of Cariprazine and acts as the predominant circulating active moiety. Didesmethyl cariprazine has a long half-life of 1-3 weeks. Cariprazine is a antipsychotic drug candidate that exhibits high affinity for the D3 and […]