Tag: Modulator

For research use only. We do not sell to patients. CDPPB CAS No. : 781652-57-1 Biological Activity：CDPPB is a potent, selective and brain penetrant positive allosteric modulator of the metabotropic glutamate receptor subtype 5 (mGluR5), with an EC50 of 27 nM in Chinese hamster ovary cells expressing human mGluR5. CDPPB may provide an approach for […]

For research use only. We do not sell to patients. LY117018 CAS No. : 63676-25-5 Biological Activity：LY117018, a Raloxifene analog, is a selective estrogen receptor modulator. LY117018 exerts antiproliferative effects on breast cancer cell lines[2]. Research Area：Cancer Targets：Estrogen Receptor/ERR Related Small Molecules:DS20362725;LSD1/ER-IN-1;Giredestrant;Avobenzone;Estriol-d3;Chrysin;ERRγ Inverse Agonist 1;(R)-DPN;MPP hydrochloride;GPR30 agonist-1;Diethylstilbestrol;Endoxifen;Glicoricone;ERB-196;Dihydroresveratrol;FLTX1;(Rac)-Hexestrol-d6 Trending products：Recombinant Proteins  |  Bioactive Screening Libraries  |  […]

For research use only. We do not sell to patients. GluN2B receptor modulator-1 CAS No. : 2222010-71-9 Biological Activity：GluN2B receptor modulator-1 is a selective GluN2B negative allosteric modulator with an IC50 value of 31 nM. Research Area：Neurological Disease Targets：iGluR Related Small Molecules:CIQ;Quinolinic acid-d3;1-Aminocyclobutanecarboxylic acid;Glycine-1-13C,15N;ZL006;PYD-106;NMDA-IN-2;JAMI1001A;(S)-Willardiine;Fanapanel;(S)-AMPA;L-Glutamic acid-15N,d5;PDZ1 Domain inhibitor peptide TFA;Ifenprodil tartrate;Rislenemdaz;Coluracetam;Flupirtine-d4 hydrochloride;DL-Phenylalanine-d5 hydrochloride;NMDA;CFM-2;Lanicemine dihydrochloride;L-Phenylalanine-13C9;VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA;L-Glutamic acid […]

For research use only. We do not sell to patients. Methylproamine CAS No. : 188247-01-0 Biological Activity：Methylproamine is a DNA-binding radioprotector, acts by repair of transient radiation-induced oxidative species on DNA. Methylproamine also protects against ionizing radiation by preventing DNA double-strand breaks. Research Area：Others Targets：DNA/RNA Synthesis Related Screening Libraries:Bioactive Compound Library Plus;Cell Cycle/DNA Damage Compound […]

For research use only. We do not sell to patients. mGluR2 modulator 3 CAS No. : 1004614-58-7 Biological Activity：mGluR2 modulator 3 (compound 1) is a potent mGluR2 positive allosteric modulator with an EC50 value of 0.87 μM. mGluR2 modulator 3 has activity in psychosis disease models such as methamphetamine-induced hyperactivity and mescaline-induced scratching in mice. […]

For research use only. We do not sell to patients. Aniracetam CAS No. : 72432-10-1 Biological Activity：Aniracetam (Ro 13-5057) is an orally active neuroprotective agent, possessing nootropics effects. Aniracetam potentiates the ionotropic quisqualate (iQA) responses in the CA1 region of rat hippocampal slices. Aniracetam also potentiates the excitatory post synaptic potentials (EPSPs) in Schaffer collateral-commissural […]

For research use only. We do not sell to patients. Poricoic acid A CAS No. : 137551-38-3 Biological Activity：Poricoic acid A, isolated from Poria cocos, possesses anti-tumor activity. Poricoic acid A enhances melatonin inhibition of AKI-to-CKD transition by regulating Gas6/AxlNFκB/Nrf2 axis[2]. Research Area：Cancer Targets：Keap1-Nrf2|NF-κB Related Screening Libraries:Natural Product Library Plus;Bioactive Compound Library Plus;Immunology/Inflammation Compound Library;NF-κB […]

For research use only. We do not sell to patients. DiMNF CAS No. : 14756-24-2 Biological Activity：DiMNF (3′,4′-Dimethoxy-αNF) is a selective aryl hydrocarbon receptor (AHR) modulator. DiMNF is a competitive AHR ligand (IC50 = 21 nM) with apparent antagonistic activity. DiMNF can be used as an anti-inflammatory agent. Research Area：Inflammation/Immunology Targets：Aryl Hydrocarbon Receptor Related Small […]

For research use only. We do not sell to patients. Idoxifene CAS No. : 116057-75-1 Biological Activity：Idoxifene (CB7432) is a novel tissue-specific selective estrogen receptor modulator (SERM). Research Area：Cancer Targets：Estrogen Receptor/ERR Related Small Molecules:DS20362725;LSD1/ER-IN-1;Giredestrant;Avobenzone;Estriol-d3;Chrysin;ERRγ Inverse Agonist 1;(R)-DPN;MPP hydrochloride;GPR30 agonist-1;Diethylstilbestrol;Endoxifen;Glicoricone;ERB-196;Dihydroresveratrol;FLTX1;(Rac)-Hexestrol-d6 Trending products：Recombinant Proteins  |  Bioactive Screening Libraries  |  Natural Products  |  Fluorescent Dye  |  PROTAC  |  […]

For research use only. We do not sell to patients. VU0469650 CAS No. : 1443748-47-7 Biological Activity：VU0469650 is a potent, selective and CNS-penetrated negative allosteric modulator of mGlu1 receptor, with an IC50 of 99 nM. Research Area：Cancer|Neurological Disease Targets：mGluR Related Small Molecules:LY3020371 hydrochloride;ZJ43;FPTQ;(S)-MCPG;mGluR2 modulator 1;VU6010572;Mavoglurant racemate;DFMTI;JNJ16259685;Auglurant;FITM;(-)-Camphoric acid;LY367385 hydrochloride;Cinnabarinic acid;LY379268;AZD 9272;mGluR2 antagonist 1;ABP688;FTIDC;MPPG;L-AP3;VU6001966;VU0155041 sodium;VU 0364439;trans-ACPD;AZD-8529 mesylate;VU […]