For research use only. We do not sell to patients.

PF-06291874

CAS No. : 1393124-08-7

Biological Activity：PF-06291874 is a highly potent, non-peptide and orally active glucagon receptor antagonist. PF-06291874 is under the study for type 2 diabetes mellitus (T2DM)^[2].

Research Area：Metabolic Disease

Targets：GCGR

Related Screening Libraries:Drug Repurposing Compound Library Plus;Clinical Compound Library Plus;Bioactive Compound Library Plus;GPCR/G Protein Compound Library;Clinical Compound Library;Drug Repurposing Compound Library;Anti-diabetic Compound Library;Anti-COVID-19 Compound Library;Orally Active Compound Library;Targeted Diversity Library;

Related Small Molecules:BETP;GLP-1R agonist 4;VU0453379;Utreglutide;TT-OAD2;Efocipegtrutide;GLP-1 receptor agonist 2;NNC-0640;Cochinchinenin C;{Val1}-Exendin-3/4;GLP-1(28-36)amide TFA;Exendin-4 acetate;Glepaglutide;GLP-1(7-37);GLP-1 receptor agonist 4;Avexitide;Exendin-3/4 (59-86);FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS;GLP-1R modulator C16;GLP-1(9-36)amide;LSN3318839;GLP-1R agonist 5

About Us:

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use；
Structurally and synthetically diverse biologically active compounds；
roduct quality is the key to our success and we take pride in offering only the highest-grade products.；
We provide HNMR, LC-MS, HPLC, stability testing and activity assays of our products to clients.；
Product identity, quality, purity and activity are assured by our robust quality control programs and procedures.；

Structurally and synthetically diverse biologically active compounds；

Customized order volume ranging from milligrams to kilograms scale；

We provide customer-oriented services. To explore more, please contact us at [email protected]. Our team will gladly assist you.

Top Publications Citing Use of MCE Products