For research use only. We do not sell to patients.

H-Ile-Pro-Pro-OH

CAS No. : 26001-32-1

Biological Activity：H-Ile-Pro-Pro-OH, a milk-derived peptide, inhibits angiotensin-converting enzyme (ACE) with an IC₅₀ of 5 μM^[2]. Antihypertensive tripeptides.

Research Area：Cardiovascular Disease

Targets：Angiotensin-converting Enzyme (ACE)

Related Small Molecules:Imidaprilate-d5;Mca-Ala-Pro-Lys(Dnp)-OH;Abz-FR-K(Dnp)-P-OH;H-Tyr-Tyr-OH;Deserpidine;BMS-265246;Vicenin 3;Delapril hydrochloride;Vicenin 2;Cilazapril;Phosphoramidon Disodium;N-Acetyl-Ser-Asp-Lys-Pro TFA;AD012;STIEEQAKTFLDKFNHEAEDLFYQSSLASWN;NCX899;Utibapril;Pivalopril;Rentiapril racemate;(R)-MLN-4760;AD013

About Us:

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use；
Structurally and synthetically diverse biologically active compounds；
roduct quality is the key to our success and we take pride in offering only the highest-grade products.；
We provide HNMR, LC-MS, HPLC, stability testing and activity assays of our products to clients.；
Product identity, quality, purity and activity are assured by our robust quality control programs and procedures.；

Structurally and synthetically diverse biologically active compounds；

Customized order volume ranging from milligrams to kilograms scale；

We provide customer-oriented services. To explore more, please contact us at [email protected]. Our team will gladly assist you.

Top Publications Citing Use of MCE Products