Orphenadrine citrate

For research use only. We do not sell to patients.

Orphenadrine citrate

CAS No. : 4682-36-4

Biological Activity:Orphenadrine citrate is an orally active and non-competitive NMDA receptor antagonist (crosses the blood-brain barrier) with a Ki of 6.0 μM. Orphenadrine citrate relieves stiffness, pain and discomfort due to muscle strains, sprains or other injuries. Orphenadrine citrate is also used to relieve tremors associated with parkinson’s disease. Orphenadrine citrate has good neuroprotective properties, can be used in studies of neurodegenerative diseases[2].

Research Area:Neurological Disease

Targets:iGluR

Related Screening Libraries:Drug Repurposing Compound Library Plus;FDA-Approved Drug Library Plus;FDA-Approved Drug Library Mini;Bioactive Compound Library Plus;Membrane Transporter/Ion Channel Compound Library;Neuronal Signaling Compound Library; FDA-Approved Drug Library;CNS-Penetrant Compound Library;Drug Repurposing Compound Library;Orally Active Compound Library;Neurotransmitter Receptor Compound Library;FDA Approved & Pharmacopeial Drug Library;Anti-Alzheimer’s Disease Compound Library;Neuroprotective Compound Library;Drug-Induced Liver Injury (DILI) Compound Library;Anti-Parkinson’s Disease Compound Library;Neurodegenerative Disease-related Compound Library;Antidepressant Compound Library;

Related Small Molecules:CIQ;Quinolinic acid-d3;1-Aminocyclobutanecarboxylic acid;Glycine-1-13C,15N;ZL006;PYD-106;NMDA-IN-2;JAMI1001A;(S)-Willardiine;Fanapanel;(S)-AMPA;L-Glutamic acid-15N,d5;PDZ1 Domain inhibitor peptide TFA;Ifenprodil tartrate;Rislenemdaz;Coluracetam;Flupirtine-d4 hydrochloride;DL-Phenylalanine-d5 hydrochloride;NMDA;CFM-2;Lanicemine dihydrochloride;L-Phenylalanine-13C9;VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA;L-Glutamic acid monosodium salt;Glycine-15N;Ibotenic acid;GYKI-47261 dihydrochloride;Sunifiram

Trending products:Recombinant Proteins  |  Bioactive Screening Libraries  |  Natural Products  |  Fluorescent Dye  |  PROTAC  |  Isotope-Labeled Compounds  |  Oligonucleotides

About Us:

  • MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use;
  • Structurally and synthetically diverse biologically active compounds;
  •  roduct quality is the key to our success and we take pride in offering only the highest-grade products.;
  • We provide HNMR, LC-MS, HPLC, stability testing and activity assays of our products to clients.;
  • Product identity, quality, purity and activity are assured by our robust quality control programs and procedures.;
  • Structurally and synthetically diverse biologically active compounds;

  • Customized order volume ranging from milligrams to kilograms scale;
  • We provide customer-oriented services. To explore more, please contact us at [email protected]. Our team will gladly assist you.

50K Diversity Library
Top Publications Citing Use of MCE Products
Recombinant Proteins
magnetic-beads