For research use only. We do not sell to patients.
Cotadutide
CAS No. : 1686108-82-6
Biological Activity：Cotadutide (MEDI0382) is a potent dual agonist of glucagon-like peptide-1 (GLP-1) and GCGR with EC50 values of 6.9 pM and 10.2 pM, respectively. Cotadutide exhibits ability to facilitate both weight loss and glycaemic control, and alleviate fibrosis. Cotadutide can be used in the research of obesity and type 2 diabetes (T2D)[2][3].
Research Area：Metabolic Disease
Targets：GCGR
Related Small Molecules:BETP;GLP-1R agonist 4;VU0453379;PF-06291874;Utreglutide;TT-OAD2;Efocipegtrutide;GLP-1 receptor agonist 2;NNC-0640;Cochinchinenin C;{Val1}-Exendin-3/4;GLP-1(28-36)amide TFA;Exendin-4 acetate;Glepaglutide;GLP-1(7-37);GLP-1 receptor agonist 4;Avexitide;Exendin-3/4 (59-86);FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS;GLP-1R modulator C16;GLP-1(9-36)amide;LSN3318839;GLP-1R agonist 5
Trending products：Recombinant Proteins | Bioactive Screening Libraries | Natural Products | Fluorescent Dye | PROTAC | Isotope-Labeled Compounds | Oligonucleotides
About Us:
- MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use；
- Structurally and synthetically diverse biologically active compounds；
- roduct quality is the key to our success and we take pride in offering only the highest-grade products.；
- We provide HNMR, LC-MS, HPLC, stability testing and activity assays of our products to clients.；
- Product identity, quality, purity and activity are assured by our robust quality control programs and procedures.；
- Customized order volume ranging from milligrams to kilograms scale；
Structurally and synthetically diverse biologically active compounds；
We provide customer-oriented services. To explore more, please contact us at [email protected]. Our team will gladly assist you.
