For research use only. We do not sell to patients.
Coluracetam
CAS No. : 135463-81-9
Biological Activity:Coluracetam(MKC-231) is a new choline uptake enhancer.
IC50 value:
Target:
in vitro: MKC-231 (10(-10)-10(-6) moll) significantly increased high affinity choline uptake (HACU) when it was incubated with the hippocampal synaptosomes of ethylcholine mustard aziridinium ion (AF64A) treated rats, but not of normal rats. MKC-231 did not affect the AChE activity, [3H]- quinuclidinyl benzilate binding, and [3H]-pirenzepine binding [1].
in vivo: Oral administration of MKC-231 (1-10 mg/kg) significantly improved the learning deficits in the Morris’ water maze of AF64A-treated rats, but it did not produce any significant side effects, like tremor, salivation or hypothermia, which were observed in rats treated with high doses of tacrine [1]. In acute behavioral experiments, MKC-231 and THA had no significant effect on AF64A-induced memory deficits at any doses tested (0.3, 1.0 and 3.0 mg/kg), whereas Dup 996, at a dose of 1.0 mg/kg, significantly improved memory deficits. In chronic experiments, MKC-231 improved memory deficit at all doses tested (0.3, 1.0, or 3.0 mg/kg p.o., once daily for 11 days) and Dup 996 did so only at a dose of 3.0 mg/kg, whereas THA did not improve memory deficit at any doses tested [2].
Research Area:Neurological Disease
Targets:iGluR
Related Screening Libraries:Bioactive Compound Library Plus;Membrane Transporter/Ion Channel Compound Library;Neuronal Signaling Compound Library;Neurotransmitter Receptor Compound Library;FDA Approved & Pharmacopeial Drug Library;
Related Small Molecules:CIQ;Quinolinic acid-d3;1-Aminocyclobutanecarboxylic acid;Glycine-1-13C,15N;ZL006;PYD-106;NMDA-IN-2;JAMI1001A;(S)-Willardiine;Fanapanel;(S)-AMPA;L-Glutamic acid-15N,d5;PDZ1 Domain inhibitor peptide TFA;Ifenprodil tartrate;Rislenemdaz;Flupirtine-d4 hydrochloride;DL-Phenylalanine-d5 hydrochloride;NMDA;CFM-2;Lanicemine dihydrochloride;L-Phenylalanine-13C9;VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA;L-Glutamic acid monosodium salt;Glycine-15N;Ibotenic acid;GYKI-47261 dihydrochloride;Sunifiram
Trending products:Recombinant Proteins | Bioactive Screening Libraries | Natural Products | Fluorescent Dye | PROTAC | Isotope-Labeled Compounds | Oligonucleotides
About Us:
- MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use;
- Structurally and synthetically diverse biologically active compounds;
- roduct quality is the key to our success and we take pride in offering only the highest-grade products.;
- We provide HNMR, LC-MS, HPLC, stability testing and activity assays of our products to clients.;
- Product identity, quality, purity and activity are assured by our robust quality control programs and procedures.;
- Customized order volume ranging from milligrams to kilograms scale;
Structurally and synthetically diverse biologically active compounds;
We provide customer-oriented services. To explore more, please contact us at [email protected]. Our team will gladly assist you.