For research use only. We do not sell to patients.

Captopril

CAS No. : 62571-86-2

Biological Activity：Captopril (SQ 14225), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC₅₀=0.025 μM) and has been widely used for research of hypertension and congestive heart failure. Captopril is also a New Delhi metallo-β-lactamase-1 (NDM-1) inhibitor with an IC₅₀ of 7.9 μM^[2]^[3].

Research Area：Cardiovascular Disease

Targets：Angiotensin-converting Enzyme (ACE)

Related Screening Libraries:Covalent Screening Library Plus;Drug Repurposing Compound Library Plus; FDA-Approved Drug Library Plus;FDA-Approved Drug Library Mini;Bioactive Compound Library Plus;Metabolism/Protease Compound Library;FDA-Approved Drug Library;Anti-Cancer Compound Library;Antiviral Compound Library;Peptidomimetic Library;Drug Repurposing Compound Library;Covalent Screening Library;Anti-diabetic Compound Library;Anti-Cardiovascular Disease Compound Library;Anti-COVID-19 Compound Library;NMPA-Approved Drug Library;Orally Active Compound Library;FDA Approved & Pharmacopeial Drug Library;Drug-Induced Liver Injury (DILI) Compound Library;Angiogenesis-Related Compound Library;Rare Diseases Drug Library;Children’s Drug Library;FDA-Approved Anticancer Drug Library;Human Metabolite Library;Non-steroidal Anti-Inflammatory Compound Library;

Related Small Molecules:Imidaprilate-d5;Mca-Ala-Pro-Lys(Dnp)-OH;Abz-FR-K(Dnp)-P-OH;H-Tyr-Tyr-OH;Deserpidine;BMS-265246;Vicenin 3;Delapril hydrochloride;Vicenin 2;Cilazapril;Phosphoramidon Disodium;N-Acetyl-Ser-Asp-Lys-Pro TFA;AD012;STIEEQAKTFLDKFNHEAEDLFYQSSLASWN;NCX899;Utibapril;Pivalopril;Rentiapril racemate;(R)-MLN-4760;AD013

About Us:

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use；
Structurally and synthetically diverse biologically active compounds；
roduct quality is the key to our success and we take pride in offering only the highest-grade products.；
We provide HNMR, LC-MS, HPLC, stability testing and activity assays of our products to clients.；
Product identity, quality, purity and activity are assured by our robust quality control programs and procedures.；

Structurally and synthetically diverse biologically active compounds；

Customized order volume ranging from milligrams to kilograms scale；

We provide customer-oriented services. To explore more, please contact us at [email protected]. Our team will gladly assist you.

Top Publications Citing Use of MCE Products