For research use only. We do not sell to patients.
Captopril
CAS No. : 62571-86-2
Biological Activity:Captopril (SQ 14225), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC50=0.025 μM) and has been widely used for research of hypertension and congestive heart failure. Captopril is also a New Delhi metallo-β-lactamase-1 (NDM-1) inhibitor with an IC50 of 7.9 μM[2][3].
Research Area:Cardiovascular Disease
Targets:Angiotensin-converting Enzyme (ACE)
Related Screening Libraries:Covalent Screening Library Plus;Drug Repurposing Compound Library Plus; FDA-Approved Drug Library Plus;FDA-Approved Drug Library Mini;Bioactive Compound Library Plus;Metabolism/Protease Compound Library;FDA-Approved Drug Library;Anti-Cancer Compound Library;Antiviral Compound Library;Peptidomimetic Library;Drug Repurposing Compound Library;Covalent Screening Library;Anti-diabetic Compound Library;Anti-Cardiovascular Disease Compound Library;Anti-COVID-19 Compound Library;NMPA-Approved Drug Library;Orally Active Compound Library;FDA Approved & Pharmacopeial Drug Library;Drug-Induced Liver Injury (DILI) Compound Library;Angiogenesis-Related Compound Library;Rare Diseases Drug Library;Children’s Drug Library;FDA-Approved Anticancer Drug Library;Human Metabolite Library;Non-steroidal Anti-Inflammatory Compound Library;
Related Small Molecules:Imidaprilate-d5;Mca-Ala-Pro-Lys(Dnp)-OH;Abz-FR-K(Dnp)-P-OH;H-Tyr-Tyr-OH;Deserpidine;BMS-265246;Vicenin 3;Delapril hydrochloride;Vicenin 2;Cilazapril;Phosphoramidon Disodium;N-Acetyl-Ser-Asp-Lys-Pro TFA;AD012;STIEEQAKTFLDKFNHEAEDLFYQSSLASWN;NCX899;Utibapril;Pivalopril;Rentiapril racemate;(R)-MLN-4760;AD013
Trending products:Recombinant Proteins | Bioactive Screening Libraries | Natural Products | Fluorescent Dye | PROTAC | Isotope-Labeled Compounds | Oligonucleotides
About Us:
- MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use;
- Structurally and synthetically diverse biologically active compounds;
- roduct quality is the key to our success and we take pride in offering only the highest-grade products.;
- We provide HNMR, LC-MS, HPLC, stability testing and activity assays of our products to clients.;
- Product identity, quality, purity and activity are assured by our robust quality control programs and procedures.;
- Customized order volume ranging from milligrams to kilograms scale;
Structurally and synthetically diverse biologically active compounds;
We provide customer-oriented services. To explore more, please contact us at [email protected]. Our team will gladly assist you.