For research use only. We do not sell to patients.
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA
Biological Activity:VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 – NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain.
Research Area:Neurological Disease
Targets:Others|iGluR
Related Small Molecules:Immune initiator-1;Obiltoxaximab;DIBAC-GGFG-NH2CH2-Dxd;Cyanine5.5 maleimide chloride;Cymarin;Z-Glycine;2-Deoxy-2-fluoro-D-glucose-13C,d7;Water-18O;Fmoc-N-Me-D-Ala-OH;3,5-Diiodo-L-tyrosine;N3-Pen-Dde;Zimeldine-d6;Ornidazole diol;Nylidrin hydrochloride;PFI-653;N-Arachidonoyl Taurine-d4;OVA Peptide (323-339);((3-Fluorophenyl)sulfonyl)glycine;7ß-Hydroxycholesterol-d7;MALAT1-IN-1;Sibiricose A1;Mefruside-d3;Ethacrynic acid mercapturate-d3;FLAG peptide;Neocurdione
Trending products:Recombinant Proteins | Bioactive Screening Libraries | Natural Products | Fluorescent Dye | PROTAC | Isotope-Labeled Compounds | Oligonucleotides
About Us:
- MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use;
- Structurally and synthetically diverse biologically active compounds;
- roduct quality is the key to our success and we take pride in offering only the highest-grade products.;
- We provide HNMR, LC-MS, HPLC, stability testing and activity assays of our products to clients.;
- Product identity, quality, purity and activity are assured by our robust quality control programs and procedures.;
- Customized order volume ranging from milligrams to kilograms scale;
Structurally and synthetically diverse biologically active compounds;
We provide customer-oriented services. To explore more, please contact us at [email protected]. Our team will gladly assist you.