For research use only. We do not sell to patients.

Vicenin 3

CAS No. : 59914-91-9

Biological Activity：Vicenin 3 is an angiotensin-converting enzyme (ACE) inhibitor (IC₅₀=46.91 μM) from the aerial parts of Desmodium styracifolium.

Research Area：Cardiovascular Disease

Targets：Angiotensin-converting Enzyme (ACE)

Related Screening Libraries:Natural Product Library Plus;Bioactive Compound Library Plus;Metabolism/Protease Compound Library;Natural Product Library;Glycoside Compound Library;Lipid Compound Library;Anti-Cardiovascular Disease Compound Library;Medicine Food Homology Compound Library;Phenols Library;Traditional Chinese Medicine Active Compound Library;Flavonoids Library;Angiogenesis-Related Compound Library;Food-Sourced Compound Library ;Plant-Sourced Natural Product Library;

Related Small Molecules:Imidaprilate-d5;Mca-Ala-Pro-Lys(Dnp)-OH;Abz-FR-K(Dnp)-P-OH;H-Tyr-Tyr-OH;Deserpidine;BMS-265246;Delapril hydrochloride;Vicenin 2;Cilazapril;Phosphoramidon Disodium;N-Acetyl-Ser-Asp-Lys-Pro TFA;AD012;STIEEQAKTFLDKFNHEAEDLFYQSSLASWN;NCX899;Utibapril;Pivalopril;Rentiapril racemate;(R)-MLN-4760;AD013

About Us:

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use；
Structurally and synthetically diverse biologically active compounds；
roduct quality is the key to our success and we take pride in offering only the highest-grade products.；
We provide HNMR, LC-MS, HPLC, stability testing and activity assays of our products to clients.；
Product identity, quality, purity and activity are assured by our robust quality control programs and procedures.；

Structurally and synthetically diverse biologically active compounds；

Customized order volume ranging from milligrams to kilograms scale；

We provide customer-oriented services. To explore more, please contact us at [email protected]. Our team will gladly assist you.

Top Publications Citing Use of MCE Products