For research use only. We do not sell to patients.

Shanzhiside methyl ester

CAS No. : 64421-28-9

Biological Activity：Shanzhiside methy lester is isolated from lamiophlomis rotata. Shanzhiside methyl ester is a small molecule glucagon-like peptide-1 (GLP-1) receptor agonist and has the ability to induce anti-allodynic tolerance.

Research Area：Neurological Disease

Targets：GCGR

Related Screening Libraries:Natural Product Library Plus;Bioactive Compound Library Plus;GPCR/G Protein Compound Library;Natural Product Library;Glycoside Compound Library;Medicine Food Homology Compound Library;Terpenoids Library;Traditional Chinese Medicine Active Compound Library;Plant-Sourced Natural Product Library;

Related Small Molecules:BETP;GLP-1R agonist 4;VU0453379;PF-06291874;Utreglutide;TT-OAD2;Efocipegtrutide;GLP-1 receptor agonist 2;NNC-0640;Cochinchinenin C;{Val1}-Exendin-3/4;GLP-1(28-36)amide TFA;Exendin-4 acetate;Glepaglutide;GLP-1(7-37);GLP-1 receptor agonist 4;Avexitide;Exendin-3/4 (59-86);FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS;GLP-1R modulator C16;GLP-1(9-36)amide;LSN3318839;GLP-1R agonist 5

About Us:

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use；
Structurally and synthetically diverse biologically active compounds；
roduct quality is the key to our success and we take pride in offering only the highest-grade products.；
We provide HNMR, LC-MS, HPLC, stability testing and activity assays of our products to clients.；
Product identity, quality, purity and activity are assured by our robust quality control programs and procedures.；

Structurally and synthetically diverse biologically active compounds；

Customized order volume ranging from milligrams to kilograms scale；

We provide customer-oriented services. To explore more, please contact us at [email protected]. Our team will gladly assist you.

Top Publications Citing Use of MCE Products