For research use only. We do not sell to patients.
GLP-1(7-37)
CAS No. : 106612-94-6
Biological Activity：GLP-1(7-37) is an intestinal insulinotropic hormone that augments glucose induced insulin secretion.
Research Area：Metabolic Disease
Targets：GCGR
Related Small Molecules:BETP;GLP-1R agonist 4;VU0453379;PF-06291874;Utreglutide;TT-OAD2;Efocipegtrutide;GLP-1 receptor agonist 2;NNC-0640;Cochinchinenin C;{Val1}-Exendin-3/4;GLP-1(28-36)amide TFA;Exendin-4 acetate;Glepaglutide;GLP-1 receptor agonist 4;Avexitide;Exendin-3/4 (59-86);FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS;GLP-1R modulator C16;GLP-1(9-36)amide;LSN3318839;GLP-1R agonist 5
Trending products：Recombinant Proteins | Bioactive Screening Libraries | Natural Products | Fluorescent Dye | PROTAC | Isotope-Labeled Compounds | Oligonucleotides
About Us:
- MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use；
- Structurally and synthetically diverse biologically active compounds；
- roduct quality is the key to our success and we take pride in offering only the highest-grade products.；
- We provide HNMR, LC-MS, HPLC, stability testing and activity assays of our products to clients.；
- Product identity, quality, purity and activity are assured by our robust quality control programs and procedures.；
- Customized order volume ranging from milligrams to kilograms scale；
Structurally and synthetically diverse biologically active compounds；
We provide customer-oriented services. To explore more, please contact us at [email protected]. Our team will gladly assist you.
