For research use only. We do not sell to patients.

Cl-HIBO

CAS No. : 909400-43-7

Biological Activity：Cl-HIBO is a highly subtype-selective GluR1/2 agonist (EC₅₀=4.7 and 1.7 μM, respectively). Cl-HIBO is a potent AMPA receptor agonist (IC₅₀=0.22 μM). Cl-HIBO has desensitizing properties.

Research Area：Neurological Disease

Targets：iGluR

Related Small Molecules:CIQ;Quinolinic acid-d3;1-Aminocyclobutanecarboxylic acid;Glycine-1-13C,15N;ZL006;PYD-106;NMDA-IN-2;JAMI1001A;(S)-Willardiine;Fanapanel;(S)-AMPA;L-Glutamic acid-15N,d5;PDZ1 Domain inhibitor peptide TFA;Ifenprodil tartrate;Rislenemdaz;Coluracetam;Flupirtine-d4 hydrochloride;DL-Phenylalanine-d5 hydrochloride;NMDA;CFM-2;Lanicemine dihydrochloride;L-Phenylalanine-13C9;VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA;L-Glutamic acid monosodium salt;Glycine-15N;Ibotenic acid;GYKI-47261 dihydrochloride;Sunifiram

Trending products：Recombinant Proteins  |  Bioactive Screening Libraries  |  Natural Products  |  Fluorescent Dye  |  PROTAC  |  Isotope-Labeled Compounds  |  Oligonucleotides

About Us:

• MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use；
• Structurally and synthetically diverse biologically active compounds；
•  roduct quality is the key to our success and we take pride in offering only the highest-grade products.；
• We provide HNMR, LC-MS, HPLC, stability testing and activity assays of our products to clients.；
• Product identity, quality, purity and activity are assured by our robust quality control programs and procedures.；

Structurally and synthetically diverse biologically active compounds；

• Customized order volume ranging from milligrams to kilograms scale；

We provide customer-oriented services. To explore more, please contact us at [email protected]. Our team will gladly assist you.