For research use only. We do not sell to patients.

Cilazapril monohydrate

CAS No. : 92077-78-6

Biological Activity：Cilazapril Monohydrate is a angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and congestive heart failure.
Target: ACE
Cilazapril is a new nonthiol group containing angiotensin converting enzyme (ACE) inhibitor. Cilazapril has been investigated in more than 4000 patients with all degrees of hypertension, as well as in the special patient groups such as the elderly, renally impaired, and patients with concomitant diseases, such as congestive cardiac failure or chronic obstructive pulmonary disease [1]. Cilazapril is a very potent and highly effective converting enzyme inhibitor. Doses well below 5 mg/day will probably suffice for therapeutic efficacy [2].

Research Area：Cardiovascular Disease

Targets：Angiotensin-converting Enzyme (ACE)

Related Small Molecules:Imidaprilate-d5;Mca-Ala-Pro-Lys(Dnp)-OH;Abz-FR-K(Dnp)-P-OH;H-Tyr-Tyr-OH;Deserpidine;BMS-265246;Vicenin 3;Delapril hydrochloride;Vicenin 2;Cilazapril;Phosphoramidon Disodium;N-Acetyl-Ser-Asp-Lys-Pro TFA;AD012;STIEEQAKTFLDKFNHEAEDLFYQSSLASWN;NCX899;Utibapril;Pivalopril;Rentiapril racemate;(R)-MLN-4760;AD013

Trending products：Recombinant Proteins  |  Bioactive Screening Libraries  |  Natural Products  |  Fluorescent Dye  |  PROTAC  |  Isotope-Labeled Compounds  |  Oligonucleotides

About Us:

• MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use；
• Structurally and synthetically diverse biologically active compounds；
•  roduct quality is the key to our success and we take pride in offering only the highest-grade products.；
• We provide HNMR, LC-MS, HPLC, stability testing and activity assays of our products to clients.；
• Product identity, quality, purity and activity are assured by our robust quality control programs and procedures.；

Structurally and synthetically diverse biologically active compounds；

• Customized order volume ranging from milligrams to kilograms scale；

We provide customer-oriented services. To explore more, please contact us at [email protected]. Our team will gladly assist you.