For research use only. We do not sell to patients.
Benazepril hydrochloride
CAS No. : 86541-74-4
Biological Activity:Benazepril hydrochloride, an angiotensin converting enzyme inhibitor, which is a medication used to treat high blood pressure.
Target: angiotensin converting enzyme (ACE)
Benazepril hydrochloride is a medication used to treat high blood pressure (hypertension), congestive heart failure, and chronic renal failure. Upon cleavage of its ester group by the liver, benazepril hydrochloride is converted into its active form benazeprilat, a non-sulfhydryl angiotensin-converting enzyme (ACE) inhibitor [1].
Animals were randomly divided into 4 groups: sham STNx group (control), STNx group, morning benazepril hydrochloride group (MB) and evening benazepril hydrochloride group (EB).Benazepril hydrochloride was intragastrically administered at a dose of 10 mg/kg/day at 07:00 and 19:00 in the MB group and EB group respectively for 12 weeks. All the animals were synchronized to the light:dark cycle of 12:12 for 12 weeks. Systolic blood pressure (SBP), 24-h urinary protein excretion and renal function were measured at 11 weeks. Blood samples and kidneys were collected every 4 h throughout a day to detect the expression pattern of renin activity (RA), angiotensin II (AngII) and aldosterone (Ald) by radioimmunoassay (RIA) and the mRNA expression profile of clock genes (bmal1, dbp and per2) by real-time PCR at 12 weeks. Our results showed that no significant differences were noted in the SBP, 24-h urine protein excretion and renal function between the MB and EB groups. There were no significant differences in average Ald and RA content of a day between the MB group and EB group. The expression peak of bmal1 mRNA was phase-delayed by 4 to 8 h, and the diurnal variation of per2 and dbp mRNA diminished in the MB and EB groups compared with the control and STNx groups. It was concluded when the similar SBP reduction, RAAS inhibition and clock gene profile were achieved with optimal dose of benazepril hydrochloride, morning versus evening dosing of benazepril hydrochloride has the same renoprotection effects [2].
Clinical indications: Congestive heart failure; End stage renal disease; Hypertension
FDA Approved Date:
Toxicity: headaches; cough; Anaphylaxis; angioedema; hyperkalemia
Research Area:Cardiovascular Disease
Targets:Angiotensin-converting Enzyme (ACE)
Related Screening Libraries:Drug Repurposing Compound Library Plus;FDA-Approved Drug Library Plus;FDA-Approved Drug Library Mini;Bioactive Compound Library Plus;Metabolism/Protease Compound Library;FDA-Approved Drug Library;Anti-Cancer Compound Library;Peptidomimetic Library;Drug Repurposing Compound Library;Anti-Cardiovascular Disease Compound Library;Anti-COVID-19 Compound Library;NMPA-Approved Drug Library;Orally Active Compound Library;FDA Approved & Pharmacopeial Drug Library;Drug-Induced Liver Injury (DILI) Compound Library;Angiogenesis-Related Compound Library;Rare Diseases Drug Library;FDA-Approved Anticancer Drug Library;Human Metabolite Library;
Related Small Molecules:Imidaprilate-d5;Mca-Ala-Pro-Lys(Dnp)-OH;Abz-FR-K(Dnp)-P-OH;H-Tyr-Tyr-OH;Deserpidine;BMS-265246;Vicenin 3;Delapril hydrochloride;Vicenin 2;Cilazapril;Phosphoramidon Disodium;N-Acetyl-Ser-Asp-Lys-Pro TFA;AD012;STIEEQAKTFLDKFNHEAEDLFYQSSLASWN;NCX899;Utibapril;Pivalopril;Rentiapril racemate;(R)-MLN-4760;AD013
Trending products:Recombinant Proteins | Bioactive Screening Libraries | Natural Products | Fluorescent Dye | PROTAC | Isotope-Labeled Compounds | Oligonucleotides
About Us:
- MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use;
- Structurally and synthetically diverse biologically active compounds;
- roduct quality is the key to our success and we take pride in offering only the highest-grade products.;
- We provide HNMR, LC-MS, HPLC, stability testing and activity assays of our products to clients.;
- Product identity, quality, purity and activity are assured by our robust quality control programs and procedures.;
- Customized order volume ranging from milligrams to kilograms scale;
Structurally and synthetically diverse biologically active compounds;
We provide customer-oriented services. To explore more, please contact us at [email protected]. Our team will gladly assist you.