Bay 55-9837 TFA

For research use only. We do not sell to patients.

Bay 55-9837 TFA

Biological Activity:Bay 55-9837 TFA is a potent and highly selective agonist of VPAC2, with a Kd of 0.65 nM. Bay 55-9837 TFA may be a useful therapy for the research of type 2 diabetes.

Research Area:Metabolic Disease

Targets:GCGR

Related Small Molecules:BETP;GLP-1R agonist 4;VU0453379;PF-06291874;Utreglutide;TT-OAD2;Efocipegtrutide;GLP-1 receptor agonist 2;NNC-0640;Cochinchinenin C;{Val1}-Exendin-3/4;GLP-1(28-36)amide TFA;Exendin-4 acetate;Glepaglutide;GLP-1(7-37);GLP-1 receptor agonist 4;Avexitide;Exendin-3/4 (59-86);FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS;GLP-1R modulator C16;GLP-1(9-36)amide;LSN3318839;GLP-1R agonist 5

Trending products:Recombinant Proteins  |  Bioactive Screening Libraries  |  Natural Products  |  Fluorescent Dye  |  PROTAC  |  Isotope-Labeled Compounds  |  Oligonucleotides

About Us:

  • MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use;
  • Structurally and synthetically diverse biologically active compounds;
  •  roduct quality is the key to our success and we take pride in offering only the highest-grade products.;
  • We provide HNMR, LC-MS, HPLC, stability testing and activity assays of our products to clients.;
  • Product identity, quality, purity and activity are assured by our robust quality control programs and procedures.;
  • Structurally and synthetically diverse biologically active compounds;

  • Customized order volume ranging from milligrams to kilograms scale;
  • We provide customer-oriented services. To explore more, please contact us at [email protected]. Our team will gladly assist you.

50K Diversity Library
Top Publications Citing Use of MCE Products
Recombinant Proteins
magnetic-beads